Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d025044_circ_g.9 |
ID in PlantcircBase | zma_circ_010271 |
Alias | Zm10circ00035, zma_circ_0003183, GRMZM2G338493_C2 |
Organism | Zea mays |
Position | chr10: 101439904-101440368 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d025044 |
Parent gene annotation |
Vacuolar protein sorting-associated protein 54 chloroplastic |
Parent gene strand | + |
Alternative splicing | Zm00001d025044_circ_g.2 Zm00001d025044_circ_g.3 Zm00001d025044_circ_g.4 Zm00001d025044_circ_g.5 Zm00001d025044_circ_g.6 Zm00001d025044_circ_g.7 Zm00001d025044_circ_g.8 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d025044_T029:2 Zm00001d025044_T015:2 Zm00001d025044_T027:2 Zm00001d025044_T010:2 Zm00001d025044_T039:2 Zm00001d025044_T013:2 Zm00001d025044_T021:2 Zm00001d025044_T017:2 Zm00001d025044_T004:2 Zm00001d025044_T002:2 Zm00001d025044_T008:2 Zm00001d025044_T005:2 Zm00001d025044_T025:2 Zm00001d025044_T040:2 Zm00001d025044_T019:2 Zm00001d025044_T034:2 Zm00001d025044_T003:2 Zm00001d025044_T037:2 Zm00001d025044_T035:2 Zm00001d025044_T023:2 Zm00001d025044_T030:2 Zm00001d025044_T012:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.282949299 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
101440295-101439981(+) 101439927-101440186(-) |
Potential amino acid sequence |
MVETGNYVDWDVVQDVAVFGVNSVQASGSNISFTYYRSIYKIGSQYSSGKG*(+) MKYLNHLPAQNSRQKRQHLGPRPNQHSFQFPPLNIYRHESVPNVQSIIHQLSSQSSQPRIRQED HNLE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |