Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d025044_circ_g.9 | 
| ID in PlantcircBase | zma_circ_010271 | 
| Alias | Zm10circ00035, zma_circ_0003183, GRMZM2G338493_C2 | 
| Organism | Zea mays | 
| Position | chr10: 101439904-101440368 JBrowse» | 
| Reference genome | AGPv4.38 | 
| Type | u-circRNA | 
| Identification method | CIRI2, find_circ | 
| Parent gene | Zm00001d025044 | 
| Parent gene annotation | Vacuolar protein sorting-associated protein 54 chloroplastic | 
| Parent gene strand | + | 
| Alternative splicing | Zm00001d025044_circ_g.2 Zm00001d025044_circ_g.3 Zm00001d025044_circ_g.4 Zm00001d025044_circ_g.5 Zm00001d025044_circ_g.6 Zm00001d025044_circ_g.7 Zm00001d025044_circ_g.8 | 
| Support reads | NA | 
| Tissues | leaf, endosperm, root | 
| Exon boundary | Yes-Yes | 
| Splicing signals | GT-AG | 
| Number of exons covered | Zm00001d025044_T029:2 Zm00001d025044_T015:2 Zm00001d025044_T027:2 Zm00001d025044_T010:2 Zm00001d025044_T039:2 Zm00001d025044_T013:2 Zm00001d025044_T021:2 Zm00001d025044_T017:2 Zm00001d025044_T004:2 Zm00001d025044_T002:2 Zm00001d025044_T008:2 Zm00001d025044_T005:2 Zm00001d025044_T025:2 Zm00001d025044_T040:2 Zm00001d025044_T019:2 Zm00001d025044_T034:2 Zm00001d025044_T003:2 Zm00001d025044_T037:2 Zm00001d025044_T035:2 Zm00001d025044_T023:2 Zm00001d025044_T030:2 Zm00001d025044_T012:2 | 
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA | 
| PMCS | 0.282949299 | 
| Functional Information | |
|---|---|
| Coding potential | Y | 
| Potential coding position | 101440295-101439981(+) 101439927-101440186(-) | 
| Potential amino acid sequence | MVETGNYVDWDVVQDVAVFGVNSVQASGSNISFTYYRSIYKIGSQYSSGKG*(+) MKYLNHLPAQNSRQKRQHLGPRPNQHSFQFPPLNIYRHESVPNVQSIIHQLSSQSSQPRIRQED HNLE*(-) | 
| Sponge-miRNAs | NA | 
| circRNA-miRNA-mRNA network | VISUALIZATION | 
| Potential function description | NA | 
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |