Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0726800_circ_g.14 |
ID in PlantcircBase | osa_circ_032446 |
Alias | Os_ciR2127 |
Organism | Oryza sativa |
Position | chr6: 30916645-30917986 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, find_circ |
Parent gene | Os06g0726800 |
Parent gene annotation |
G2/mitotic-specific cyclin 2 (B-like cyclin) (CycOs2). (Os06t072 6800-01) |
Parent gene strand | - |
Alternative splicing | Os06g0726800_circ_g.1 Os06g0726800_circ_g.2 Os06g0726800_circ_g.3 Os06g0726800_circ_g.4 Os06g0726800_circ_g.5 Os06g0726800_circ_g.6 Os06g0726800_circ_g.7 Os06g0726800_circ_g.8 Os06g0726800_circ_g.9 Os06g0726800_circ_g.10 Os06g0726800_circ_g.11 Os06g0726800_circ_g.12 Os06g0726800_circ_g.13 Os06g0726800_circ_g.15 |
Support reads | 7/5 |
Tissues | root/root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0726800-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016653 |
PMCS | 0.319227204 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30917776-30917728(+) 30916684-30917986(-) |
Potential amino acid sequence |
MMFLMSRRALLLVFAISGACLTPSIETPWLKFSDLMFSIADVLLTPPVEAVNFINIFNYCKGVI CITAVNIRCCLLNVFHLNFFQFRTHHFVHLRHHWQWQIIRCDLGALHICWTMKCRICCPFLPLT SNGCQGSTGGLVCQCCSKFPRHRTVSSLVLSGRFI*(+) MLMKFTASTGGVSRTSAMENMRSENFNQGVSMEGVKHAPEMANTNRRALRDIKNIIGAPHQHMA VSKRGLLDKPAAKNQAGHRPMTRKFAATLANQPSSAPLAPIGSERQKRTADSAFHGPADMECTK ITSDDLPLPMMSEMDEVMGSELKEIEMEDIEEAAPDIDSCDANNSLAVVEYVDEIYSFYRRSE* (-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |