Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0726800_circ_g.15 |
| ID in PlantcircBase | osa_circ_032447 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 30916878-30917986 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0726800 |
| Parent gene annotation |
G2/mitotic-specific cyclin 2 (B-like cyclin) (CycOs2). (Os06t072 6800-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0726800_circ_g.1 Os06g0726800_circ_g.2 Os06g0726800_circ_g.3 Os06g0726800_circ_g.4 Os06g0726800_circ_g.5 Os06g0726800_circ_g.6 Os06g0726800_circ_g.7 Os06g0726800_circ_g.8 Os06g0726800_circ_g.9 Os06g0726800_circ_g.10 Os06g0726800_circ_g.11 Os06g0726800_circ_g.12 Os06g0726800_circ_g.13 Os06g0726800_circ_g.14 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0726800-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_016655 osi_circ_016654 |
| PMCS | 0.100694469 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30917776-30917728(+) |
| Potential amino acid sequence |
MMFLMSRRALLLVFAISGACLTPSIETPWLKFSDLMFSIADVLHFVHLRHHWQWQIIRCDLGAL HICWTMKCRICCPFLPLTSNGCQGSTGGLVCQCCSKFPRHRTVSSLVLSGRFI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |