Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0431600_circ_g.1 |
ID in PlantcircBase | osa_circ_039272 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 15792799-15794926 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0431600 |
Parent gene annotation |
Cystathionine beta-synthase, core domain containing protein. (Os 09t0431600-00) |
Parent gene strand | + |
Alternative splicing | Os09g0431600_circ_g.2 Os09g0431600_circ_g.3 Os09g0431600_circ_g.4 Os09g0431600_circ_g.5 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0431600-00:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008071* osi_circ_018503 |
PMCS | 0.139654828 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15793931-15792824(+) 15792834-15794819(-) |
Potential amino acid sequence |
MRRANALVARFRQVLYEGHSVLLYNLLMKGYIKSNFPLGALTVKDEILRQGLKPDRLTYNTIIS ACVKSAEIDMAIRFLEDMKEEAKRDNNPELLPDAVTYTTLLKGLGNSQDLYSVLKIVVEMKSAP ISIDRTAYTAMVDALLACGSINGSGDSEKDR*(+) MRHLSFSLSPDPLIDPQASKASTIAVYAVRSIEIGADFISTTIFKTE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |