Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA030810_circ_g.4 |
ID in PlantcircBase | osi_circ_008071 |
Alias | 9:14331416|14333543 |
Organism | Oryza sativa ssp. indica |
Position | chr9: 14331416-14333543 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA030810 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA030810_circ_g.1 BGIOSGA030810_circ_g.2 BGIOSGA030810_circ_g.3 BGIOSGA030810_circ_g.5 BGIOSGA030810_circ_g.6 BGIOSGA030810_circ_g.7 BGIOSGA030810_circ_g.8 BGIOSGA030810_circ_g.9 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA030810-TA:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_039272* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14331451-14333436(-) 14332548-14331441(+) |
Potential amino acid sequence |
MRHLSFSLSPDPLIDPQASKASTIAVYAVRSIEIGADFISTTIFKTE*(-) MRRANALVARFRQVLYEGHSVLLYNLLMKGYIKSNFPLGALTVKDEILRQGLKPDRLTYNTIIS ACVKSAEIDMAIRFLEDMKEEAKRDNNPELLPDAVTYTTLLKGLGNSQDLYSVLKIVVEMKSAP ISIDRTAYTAMVDALLACGSINGSGDSEKDR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |