Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0431600_circ_g.3 |
| ID in PlantcircBase | osa_circ_039274 |
| Alias | Os_ciR11811 |
| Organism | Oryza sativa |
| Position | chr9: 15793925-15794445 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0431600 |
| Parent gene annotation |
Cystathionine beta-synthase, core domain containing protein. (Os 09t0431600-00) |
| Parent gene strand | + |
| Alternative splicing | Os09g0431600_circ_g.1 Os09g0431600_circ_g.2 Os09g0431600_circ_g.4 Os09g0431600_circ_g.5 |
| Support reads | 2/1 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0431600-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018506 |
| PMCS | 0.393408061 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15794418-15793976(+) 15793931-15794008(+) |
| Potential amino acid sequence |
MLLPTQHYLRRYAACQCSCCPFSPSPL*(+) MRRANALVARFRQVLYEGHSVLLYNLLMKGYIKSNFPLGALTVKDEILRQGLKPDRLTYNTIIS ACVKSAEIDMAIRFLEDMKEEAKRDNNPELLPDAVTYTTLLKEICGVPMLLLPVFAKSFMKATP SYYTTC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |