Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0431600_circ_g.3 |
ID in PlantcircBase | osa_circ_039274 |
Alias | Os_ciR11811 |
Organism | Oryza sativa |
Position | chr9: 15793925-15794445 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os09g0431600 |
Parent gene annotation |
Cystathionine beta-synthase, core domain containing protein. (Os 09t0431600-00) |
Parent gene strand | + |
Alternative splicing | Os09g0431600_circ_g.1 Os09g0431600_circ_g.2 Os09g0431600_circ_g.4 Os09g0431600_circ_g.5 |
Support reads | 2/1 |
Tissues | root/shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0431600-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018506 |
PMCS | 0.393408061 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15794418-15793976(+) 15793931-15794008(+) |
Potential amino acid sequence |
MLLPTQHYLRRYAACQCSCCPFSPSPL*(+) MRRANALVARFRQVLYEGHSVLLYNLLMKGYIKSNFPLGALTVKDEILRQGLKPDRLTYNTIIS ACVKSAEIDMAIRFLEDMKEEAKRDNNPELLPDAVTYTTLLKEICGVPMLLLPVFAKSFMKATP SYYTTC*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |