Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G65050_circ_g.6 |
ID in PlantcircBase | ath_circ_045895 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 25984941-25985695 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | AT5G65050 |
Parent gene annotation |
Agamous-like MADS-box protein AGL31 |
Parent gene strand | + |
Alternative splicing | AT5G65050_circ_g.1 AT5G65050_circ_g.2 5_circ_ag.3 AT5G65050_circ_g.4 AT5G65050_circ_g.5 5_circ_ag.7 AT5G65050_circ_g.8 5_circ_ag.9 5_circ_ag.10 5_circ_ag.11 AT5G65060_circ_g.1 AT5G65060_circ_g.2 AT5G65060_circ_g.3 |
Support reads | 4 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G65050.5:4 AT5G65050.4:4 AT5G65050.3:4 AT5G65050.1:3 AT5G65050.2:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.134603588 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25985312-25985692(+) |
Potential amino acid sequence |
MMGEVKSLQKTENLLREENQTLASQDLAEKTRNYLPLKELLEIVQSKLEESNVDNASVDTLISL EEQLETALSVTRARKTELMMGEVKSLQKTENLLREENQTLASQDLAEKTRNYLPLKELLEIVQS KLEESNVDNASVDTLISLEEQLETALSVTRARKTELMMGEVKSLQKTENLLREENQTLASQDLA EKTRNYLPLKELLEIVQSKLEESNVDNASVDTLISLEEQLETALSVTRARKTELMMGEVKSLQK TENLLREENQTLASQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |