Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G65050_circ_g.6 |
| ID in PlantcircBase | ath_circ_045895 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 25984941-25985695 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT5G65050 |
| Parent gene annotation |
Agamous-like MADS-box protein AGL31 |
| Parent gene strand | + |
| Alternative splicing | AT5G65050_circ_g.1 AT5G65050_circ_g.2 5_circ_ag.3 AT5G65050_circ_g.4 AT5G65050_circ_g.5 5_circ_ag.7 AT5G65050_circ_g.8 5_circ_ag.9 5_circ_ag.10 5_circ_ag.11 AT5G65060_circ_g.1 AT5G65060_circ_g.2 AT5G65060_circ_g.3 |
| Support reads | 4 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G65050.5:4 AT5G65050.4:4 AT5G65050.3:4 AT5G65050.1:3 AT5G65050.2:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.134603588 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25985312-25985692(+) |
| Potential amino acid sequence |
MMGEVKSLQKTENLLREENQTLASQDLAEKTRNYLPLKELLEIVQSKLEESNVDNASVDTLISL EEQLETALSVTRARKTELMMGEVKSLQKTENLLREENQTLASQDLAEKTRNYLPLKELLEIVQS KLEESNVDNASVDTLISLEEQLETALSVTRARKTELMMGEVKSLQKTENLLREENQTLASQDLA EKTRNYLPLKELLEIVQSKLEESNVDNASVDTLISLEEQLETALSVTRARKTELMMGEVKSLQK TENLLREENQTLASQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |