Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G65060_circ_g.3 |
ID in PlantcircBase | ath_circ_045903 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 25989942-25990655 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT5G65060 |
Parent gene annotation |
Agamous-like MADS-box protein AGL70 |
Parent gene strand | + |
Alternative splicing | AT5G65050_circ_g.1 AT5G65050_circ_g.2 5_circ_ag.3 AT5G65050_circ_g.4 AT5G65050_circ_g.5 AT5G65050_circ_g.6 5_circ_ag.7 AT5G65050_circ_g.8 5_circ_ag.9 5_circ_ag.10 5_circ_ag.11 AT5G65060_circ_g.1 AT5G65060_circ_g.2 |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G65060.3:4 AT5G65060.2:4 AT5G65060.1:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.130946895 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25990136-25990652(+) |
Potential amino acid sequence |
MEEQLETALSVIRAKKTELMMEDMKSLQEREKLLIEENQILASQDLAEKIRNYLPHKELLEIVQ SKLEESNVDNVSVDSLISMEEQLETALSVIRAKKTELMMEDMKSLQEREKLLIEENQILASQDL AEKIRNYLPHKELLEIVQSKLEESNVDNVSVDSLISMEEQLETALSVIRAKKTELMMEDMKSLQ EREKLLIEENQILASQDLAEKIRNYLPHKELLEIVQSKLEESNVDNVSVDSLISMEEQLETALS VIRAKKTELMMEDMKSLQEREKLLIEENQILASQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |