Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0239400_circ_g.7 |
ID in PlantcircBase | osa_circ_018792 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 7363162-7363586 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, CIRI, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | Os03g0239400 |
Parent gene annotation |
Similar to Transcription factor HBP-1a(C14). (Os03t0239400-01) |
Parent gene strand | - |
Alternative splicing | Os03g0239400_circ_g.1 Os03g0239400_circ_g.2 Os03g0239400_circ_g.3 Os03g0239400_circ_g.4 Os03g0239400_circ_g.5 Os03g0239400_circ_g.6 Os03g0239400_circ_g.8 |
Support reads | 3 |
Tissues | shoot, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0239400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014114 |
PMCS | 0.153250137 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7363542-7363556(-) |
Potential amino acid sequence |
MGKGEVATRSKSQKSSATQNEQSTPTNPPTAYPDWSQFQAYYNPAGTAPMTPPGFFHPNVAPSP QGHPYMWGPQNLGVKRNRVI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |