Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0239400_circ_g.8 |
| ID in PlantcircBase | osa_circ_018793 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 7363162-7363992 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os03g0239400 |
| Parent gene annotation |
Similar to Transcription factor HBP-1a(C14). (Os03t0239400-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0239400_circ_g.1 Os03g0239400_circ_g.2 Os03g0239400_circ_g.3 Os03g0239400_circ_g.4 Os03g0239400_circ_g.5 Os03g0239400_circ_g.6 Os03g0239400_circ_g.7 |
| Support reads | 3 |
| Tissues | shoot, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0239400-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004665* osi_circ_014115 |
| PMCS | 0.231449549 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7363963-7363376(+) 7363542-7363989(-) |
| Potential amino acid sequence |
MRQKIFLLASTVDPTYMGAPEDLEPHLDGKSPVGSLELSQQDYSMPEIETSPDMQ*(+) MGKGEVATRSKSQKSSATQNEQSTPTNPPTAYPDWSQFQAYYNPAGTAPMTPPGFFHPNVAPSP QGHPYMWGPQC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |