Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0239400_circ_g.4 |
ID in PlantcircBase | osa_circ_018790 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 7362213-7362882 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0239400 |
Parent gene annotation |
Similar to Transcription factor HBP-1a(C14). (Os03t0239400-01) |
Parent gene strand | - |
Alternative splicing | Os03g0239400_circ_g.1 Os03g0239400_circ_g.2 Os03g0239400_circ_g.3 Os03g0239400_circ_g.5 Os03g0239400_circ_g.6 Os03g0239400_circ_g.7 Os03g0239400_circ_g.8 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0239400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.171258371 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7362823-7362217(+) 7362884-7362881(-) 7362233-7362353(-) |
Potential amino acid sequence |
MVSLAHTSPHMAAVFHREASSV*(+) MMPPYGTPPPYAAMYAQGTPYQQAPMLPGSHPYNPYPGQSPNGTVQTPTSAGGTETDKSGKSKR KTPLKRSKGSLGNLDVVATKNKKAPAKPSASSSNEGSSHR*(-) MKVLHTDDASLWNTAAICGDVCARDTISAGTYATGFTPIQSLSRAITKWDSSNSYICWRNRDR* (-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |