Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA006435_circ_g.13 |
| ID in PlantcircBase | osi_circ_003937 |
| Alias | 2:18740343|18747304 |
| Organism | Oryza sativa ssp. indica |
| Position | chr2: 18740343-18747304 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA006435 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA006435_circ_g.1 BGIOSGA006435_circ_g.2 BGIOSGA006435_circ_g.3 BGIOSGA006435_circ_g.4 BGIOSGA006435_circ_g.5 BGIOSGA006435_circ_g.6 BGIOSGA006435_circ_g.7 BGIOSGA006435_circ_g.8 BGIOSGA006435_circ_g.9 BGIOSGA006435_circ_g.10 BGIOSGA006435_circ_g.11 BGIOSGA006435_circ_g.12 BGIOSGA006435_circ_g.14 BGIOSGA006435_circ_g.15 BGIOSGA006435_circ_g.16 BGIOSGA006435_circ_g.17 BGIOSGA006435_circ_g.18 BGIOSGA006435_circ_g.19 BGIOSGA006435_circ_g.20 BGIOSGA006435_circ_g.21 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA006435-TA:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18747249-18747300(-) 18740354-18747200(-) |
| Potential amino acid sequence |
MHVLPDLEFIEKKYKDKPFTVVGVHSAKFDNEKDLEAIRNAVLRYNITHPVVNDGDMYLWRELG VNSWPTFVVIGPNGKVLAQISGEGHRKDLDDVVGAALEFYEENKLLQNSSLPLALEKDKDSRLL ASPLKFPGKLAIDVLNNRLFISDSNHNRIVVTNLEGEFICQIGSSEEGLLDGTFDTASFNRPQG LAYNSKKNILYVADTENHALREINFVSETVKTLAGNGTKGSDYRGGGQGTNQACFFMVLNSPWD VCYDPSKETLYIAMAGQHQIWKHNTLDGVTEVLSGDGYERNLNGSRI*(-) MDRGFKRKSGPVGFLDLLLHQLHACLARPGIYREEVQG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |