Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA006435_circ_g.10 |
ID in PlantcircBase | osi_circ_003934 |
Alias | 2:18740343|18742969 |
Organism | Oryza sativa ssp. indica |
Position | chr2: 18740343-18742969 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA006435 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA006435_circ_g.1 BGIOSGA006435_circ_g.2 BGIOSGA006435_circ_g.3 BGIOSGA006435_circ_g.4 BGIOSGA006435_circ_g.5 BGIOSGA006435_circ_g.6 BGIOSGA006435_circ_g.7 BGIOSGA006435_circ_g.8 BGIOSGA006435_circ_g.9 BGIOSGA006435_circ_g.11 BGIOSGA006435_circ_g.12 BGIOSGA006435_circ_g.13 BGIOSGA006435_circ_g.14 BGIOSGA006435_circ_g.15 BGIOSGA006435_circ_g.16 BGIOSGA006435_circ_g.17 BGIOSGA006435_circ_g.18 BGIOSGA006435_circ_g.19 BGIOSGA006435_circ_g.20 BGIOSGA006435_circ_g.21 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA006435-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18741284-18742968(-) |
Potential amino acid sequence |
MVLNSPWDVCYDPSKETLYIAMAGQHQIWKHNTLDGVTEVLSGDGYERNLNGSR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |