Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0648400_circ_g.5 |
ID in PlantcircBase | osa_circ_020807 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 25129124-25129534 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0648400 |
Parent gene annotation |
Similar to DnaJ protein. (Os03t0648400-01);Similar to DnaJ prote in homolog (DNAJ-1). (Os03t0648400-02);Similar to DnaJ protein h omolog (DNAJ-1). (Os03t0648400-03);Non-protein coding transcript . (Os03t0648400-04) |
Parent gene strand | + |
Alternative splicing | Os03g0648400_circ_g.1 Os03g0648400_circ_g.2 Os03g0648400_circ_g.3 Os03g0648400_circ_g.4 Os03g0648400_circ_g.6 Os03g0648400_circ_g.7 Os03g0648400_circ_g.8 Os03g0648400_circ_g.9 Os03g0648400_circ_g.10 Os03g0648450_circ_g.1 Os03g0648450_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0648400-02:2 Os03t0648400-03:2 Os03t0648400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.431473439 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25129218-25129154(+) 25129478-25129146(+) 25129239-25129474(-) |
Potential amino acid sequence |
MGGGGSHVDPFDIFSSFFGPSFGGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNV LCAKCKGSRSLHKLMRY*(+) MVLQRSSLFPAMSSAPSARVQGACTSL*(+) MGSASTHSFLEGIFTILVIDFTFLRVTQYLISLCKLLEPLHLAQRTLRERESFFEVPL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |