Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0648400_circ_g.6 |
| ID in PlantcircBase | osa_circ_020808 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 25129124-25130172 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0648400 |
| Parent gene annotation |
Similar to DnaJ protein. (Os03t0648400-01);Similar to DnaJ prote in homolog (DNAJ-1). (Os03t0648400-02);Similar to DnaJ protein h omolog (DNAJ-1). (Os03t0648400-03);Non-protein coding transcript . (Os03t0648400-04) |
| Parent gene strand | + |
| Alternative splicing | Os03g0648400_circ_g.1 Os03g0648400_circ_g.2 Os03g0648400_circ_g.3 Os03g0648400_circ_g.4 Os03g0648400_circ_g.5 Os03g0648400_circ_g.7 Os03g0648400_circ_g.8 Os03g0648400_circ_g.9 Os03g0648400_circ_g.10 Os03g0648450_circ_g.1 Os03g0648450_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0648400-01:3 Os03t0648400-02:4 Os03t0648400-03:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.375127757 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25129218-25129146(+) 25129239-25130166(-) |
| Potential amino acid sequence |
MGGGGSHVDPFDIFSSFFGPSFGGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNV LCAKCKGKGSKSGASMRCPGCQGSGMKITIRQLGPSMIQQMQQPCNECKGTGESINEKDRCPGC KGEKVIQEKKVLEVHVEKGMQHNQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGDDLFY EHTLSLTEALCGFQFVLTHLDNRQLLIKSNPGEVVKPVQGACTSL*(+) MGSASTHSFLEGIFTILVIDFTFLRVTQYLISLCKLLEQA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |