Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0562100_circ_g.2 | 
| ID in PlantcircBase | osa_circ_009615 | 
| Alias | Os11circ07139/Os_ciR1044 | 
| Organism | Oryza sativa | 
| Position | chr11: 20947082-20948800 JBrowse» | 
| Reference genome | IRGSP-1.0.38 | 
| Type | e-circRNA | 
| Identification method | CIRCexplorer, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, circseq_cup, find_circ | 
| Parent gene | Os11g0562100 | 
| Parent gene annotation | 
							Squalene cyclase domain containing protein. (Os11t0562100-01);Si milar to cycloartenol synthase. (Os11t0562100-02)  | 
					
| Parent gene strand | + | 
| Alternative splicing | Os11g0562100_circ_g.1 Os11g0562100_circ_g.3 Os11g0562100_circ_g.4 Os11g0562100_circ_g.5 Os11g0562100_circ_g.6 Os11g0562100_circ_g.7 Os11g0562100_circ_g.8 Os11g0562100_circ_g.9 Os11g0562100_circ_g.10 Os11g0562100_circ_g.11 | 
| Support reads | 2/15/4/4 | 
| Tissues | leaf/root/root/shoot, root | 
| Exon boundary | Yes-Yes | 
| Splicing signals | GT-AG | 
| Number of exons covered | Os11t0562100-01:2 Os11t0562100-02:2  | 
					
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003188* osi_circ_009111 zma_circ_008594 | 
| PMCS | 0.462383844 | 
| Functional Information | |
|---|---|
| Coding potential | Y | 
| Potential coding position | 
							20947173-20948797(+) | 
					
| Potential amino acid sequence | 
							MNKLRERALDRLMEHIHYEDENSQYLCLCPVNKALNMVCCWVEDPNSDSFKRHLARIPDFLWLS EDGMKAQEDLVCPRTLLQNVVWTSLYKWVEPVLGSRPMNKLRERALDRLMEHIHYEDENSQYLC LCPVNKALNMVCCWVEDPNSDSFKRHLARIPDFLWLSEDGMKAQEDLVCPRTLLQNVVWTSLYK WVEPVLGSRPMNKLRERALDRLMEHIHYEDENSQYLCLCPVNKALNMVCCWVEDPNSDSFKRHL ARIPDFLWLSEDGMKAQEDLVCPRTLLQNVVWTSLYKWVEPVLGSRPMNKLRERALDRLMEHIH YEDENSQYLCLCPVNKALNMVCCWVEDPNSDSFKRHLARIPDFLWLSEDGMKAQ(+)  | 
					
| Sponge-miRNAs | NA | 
| circRNA-miRNA-mRNA network | VISUALIZATION | 
| Potential function description | NA | 
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |