Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0508400_circ_g.3 |
ID in PlantcircBase | osa_circ_007607 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 19514967-19515484 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0508400 |
Parent gene annotation |
Similar to Methionine aminopeptidase-like protein. (Os10t0508400 -01) |
Parent gene strand | + |
Alternative splicing | Os10g0508400_circ_g.4 Os10g0508400_circ_g.5 Os10g0508400_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os10t0508400-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008592 |
PMCS | 0.276078941 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19514997-19515101(-) |
Potential amino acid sequence |
MVIQWRWISTYCNSFIQALIGTTDKLLGSFINISNKICLVQITMNSFVIHSYVDIYNVTIFKFP GIWNSMADDFID*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |