Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0508400_circ_g.4 |
| ID in PlantcircBase | osa_circ_007608 |
| Alias | Os_ciR3611 |
| Organism | Oryza sativa |
| Position | chr10: 19514967-19516291 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os10g0508400 |
| Parent gene annotation |
Similar to Methionine aminopeptidase-like protein. (Os10t0508400 -01) |
| Parent gene strand | + |
| Alternative splicing | Os10g0508400_circ_g.3 Os10g0508400_circ_g.5 Os10g0508400_circ_g.6 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0508400-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.171814314 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19516255-19515106(+) 19515722-19514984(+) 19515013-19516222(-) |
| Potential amino acid sequence |
MVNGVLNLSTPFWWISISIELPFLPEVMLHVSQ*(+) MSGLSVVKSYCGHGIGELFHCAPNIPHYSRNKAVGIMKAGQTFTIEPMINTGVWHDRLWPDEWT AVTADGKRSAQFEHTLLVDIHLH*(+) MTSGRNGNSMEMDIHQKGVLKLSTPFTICSHCCPLIRP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |