Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G25220_circ_g.7 |
ID in PlantcircBase | ath_circ_040351 |
Alias | At_ciR5910 |
Organism | Arabidpsis thaliana |
Position | chr5: 8737635-8737766 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT5G25220 |
Parent gene annotation |
KNAT3 |
Parent gene strand | + |
Alternative splicing | AT5G25220_circ_g.4 AT5G25220_circ_g.5 AT5G25220_circ_g.6 AT5G25220_circ_g.8 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G25220.1:1 AT5G25220.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.432922727 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8737751-8737763(+) |
Potential amino acid sequence |
MALPYWLQGEDSRHKRGDIKEEKSWEVTRRYHLCSQSLVAISFQMALPYWLQGEDSRHKRGDIK EEKSWEVTRRYHLCSQSLVAISFQMALPYWLQGEDSRHKRGDIKEEKSWEVTRRYHLCSQSLVA ISFQMALPY(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |