Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0181333_circ_g.13 |
ID in PlantcircBase | osa_circ_006334 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 5583924-5584768 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ie-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0181333 |
Parent gene annotation |
Hypothetical protein. (Os10t0181333-00) |
Parent gene strand | + |
Alternative splicing | Os10g0181333_circ_g.3 Os10g0181333_circ_g.4 Os10g0181333_circ_g.5 Os10g0181333_circ_g.6 Os10g0181333_circ_g.7 Os10g0181333_circ_g.8 Os10g0181333_circ_g.9 Os10g0181333_circ_g.10 Os10g0181333_circ_g.11 Os10g0181333_circ_g.12 Os10g0181333_circ_g.14 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0181200-01:4 Os10t0181333-00:4 Os10t0181200-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.180033314 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5584749-5583998(+) 5584711-5584744(-) |
Potential amino acid sequence |
MQLEPIALKHSINFSTLGTSRYKCCVKFTIRF*(+) MNDHDDAKLIGWSISNLLSKENPENSTSANRAGLRGTKDVPDYLRRYNSLLIDGRLKDSVDLLE SMEQKGLLDMNKIHHASFLNACKKQRAVPEAVRFCKLINNPKMSTFNMLLSVCANSQDFDGALQ VMVLLKEAGLKPDCKLYTTLISTCAKCGKVDAMFEGDWFQLHA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |