Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0223766_circ_g.3 |
ID in PlantcircBase | osa_circ_036379 |
Alias | Os08circ05101/Os_ciR1228 |
Organism | Oryza sativa |
Position | chr8: 7497952-7498613 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, SMALT, Segemehl, circseq_cup, find_circ |
Parent gene | Os08g0223766 |
Parent gene annotation |
Similar to H0702G05.10 protein. (Os08t0223766-00) |
Parent gene strand | + |
Alternative splicing | Os08g0223766_circ_igg.1 Os08g0223766_circ_igg.2 Os08g0223766_circ_g.1 Os08g0223766_circ_g.2 Os08g0223766_circ_g.4 Os08g0223766_circ_g.5 Os08g0223766_circ_g.6 Os08g0223766_circ_ag.1 Os08g0223833_circ_g.1 Os08g0223833_circ_g.2 |
Support reads | 2/17/3/6 |
Tissues | leaf and panicle/root/root/shoot, root, seed, pistil |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0223766-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007607* osi_circ_018354 |
PMCS | 0.471483368 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7498556-7497958(+) 7497997-7498002(+) 7498005-7498252(-) |
Potential amino acid sequence |
MQKTRAIHLRFGGYTGPAIRCS*(+) MDMKARTLSYKGAAFATVEAPLEERMMNMYRKAAEFWAELRVELLSAIEYYAEDKGNSSQIWRL YWASHQVLLRKVVWVLLNLLLWT*(+) MSIATSSRAPTPPFSRAPDGWPSITAKSEMNCPCLLHNIQLLKGVQHATRPKIQLLSYTYSSFF PLEELPR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |