Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0223766_circ_g.6 |
ID in PlantcircBase | osa_circ_036382 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 7498852-7499546 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0223766 |
Parent gene annotation |
Similar to H0702G05.10 protein. (Os08t0223766-00) |
Parent gene strand | + |
Alternative splicing | Os08g0223766_circ_igg.1 Os08g0223766_circ_igg.2 Os08g0223766_circ_g.1 Os08g0223766_circ_g.2 Os08g0223766_circ_g.3 Os08g0223766_circ_g.4 Os08g0223766_circ_g.5 Os08g0223766_circ_ag.1 Os08g0223833_circ_g.1 Os08g0223833_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0223766-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.276485444 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7498868-7498859(+) 7499503-7498859(+) 7498868-7499492(-) |
Potential amino acid sequence |
MCMSAKVPAVVRLVKEALAEEKCVVIGLQSTGEARTEEAISKYGVEMEDFVSGPRELLLKLVDD NYPLPPKPDCFQQAFL*(+) MTIILCLRNLIAFNKRFFRHMCMSAKVPAVVRLVKEALAEEKCVVIGLQSTGEARTEEAISKYG VEMEDFVSGPRELLLKLVDDNYPLPPKPDCFQQAFL*(+) MPKETLVESNQVSEAKDNCHLPA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |