Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0223766_circ_g.6 |
| ID in PlantcircBase | osa_circ_036382 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 7498852-7499546 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0223766 |
| Parent gene annotation |
Similar to H0702G05.10 protein. (Os08t0223766-00) |
| Parent gene strand | + |
| Alternative splicing | Os08g0223766_circ_igg.1 Os08g0223766_circ_igg.2 Os08g0223766_circ_g.1 Os08g0223766_circ_g.2 Os08g0223766_circ_g.3 Os08g0223766_circ_g.4 Os08g0223766_circ_g.5 Os08g0223766_circ_ag.1 Os08g0223833_circ_g.1 Os08g0223833_circ_g.2 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0223766-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.276485444 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7498868-7498859(+) 7499503-7498859(+) 7498868-7499492(-) |
| Potential amino acid sequence |
MCMSAKVPAVVRLVKEALAEEKCVVIGLQSTGEARTEEAISKYGVEMEDFVSGPRELLLKLVDD NYPLPPKPDCFQQAFL*(+) MTIILCLRNLIAFNKRFFRHMCMSAKVPAVVRLVKEALAEEKCVVIGLQSTGEARTEEAISKYG VEMEDFVSGPRELLLKLVDDNYPLPPKPDCFQQAFL*(+) MPKETLVESNQVSEAKDNCHLPA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |