Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Gh_D12G2141_circ_g.2 |
| ID in PlantcircBase | ghi_circ_003444 |
| Alias | D12:54449907|54451069 |
| Organism | Gossypium hirsutum |
| Position | chrD12: 54449907-54451069 JBrowse» |
| Reference genome | v1.1 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gh_D12G2141 |
| Parent gene annotation |
SIMILAR TO: AT2G39810, ubiquitin-protein ligases |
| Parent gene strand | + |
| Alternative splicing | Gh_D12G2141_circ_g.1 |
| Support reads | 19 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gh_D12G2141:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs |
gra_circ_000873* gar_circ_000746* gra_circ_000288 gma_circ_000224* gma_circ_002912 |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
54449925-54450150(+) |
| Potential amino acid sequence |
MDETAVSSDVVTALLLDEKVVKDWVKRTFKNMATELQRIYYLEIEEMKNRLGLLLKFSVRLTSL SSVLEVLESSFKGRLSAELHDLHHLQESILKTKQHLEITMWCIRHHFLEQVRSRHADFTSWRNH VRERKSAAIVRAWPPPDVLDLSTNSTGQEASLFIEDALENLDIYEKIGDESDFAFLQKNGALSF LQSKIGGITGYYPFESLRAAVDILFLRGGSDLVVAKQAIMLQMYVWMKLLFPVMLSLLCCWMRR LLRIGSSGHLKTWQQNFSVYIILR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |