Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G175400_circ_g.2 |
| ID in PlantcircBase | gra_circ_000288 |
| Alias | Chr03:44717046|44717922 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 44717046-44717922 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G175400 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.003G175400_circ_g.1 |
| Support reads | 17/116 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.003G175400.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs |
ghi_circ_000264* ghi_circ_000860* gar_circ_000826* gar_circ_000746 ghi_circ_000199 ghi_circ_000420 |
| PMCS | 1.116116059 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
44717906-44717687(-) |
| Potential amino acid sequence |
MDETAVSSDAITALLLDEKVVKDWVKRKFKNITTELQQIYYLKVGEMEKSLGLLHKYSAYLASL SSILEVLESSFKGRPLAQLHDLHHLQESILKTKQHLEIIMWCIRHQFLEHVRSRHANFTSWHNL VRERKSAATARAWPDVVDRSADSTRQDGSLFIEDALANLDIEQACDQELGEESYFAFLLKDSSS FSRSKIEGLRGCYPFESLQAAVDILFLCGSSDLVVAKQAIMLQIYAWMKLLFPVMLSLLCYWMR RLSRIGSSGSLKILQQNFNRYIISR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |