Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_11G035800_circ_g.2 |
| ID in PlantcircBase | gma_circ_002912 |
| Alias | Gm11circRNA2096, gma-circRNA1526 |
| Organism | Glycine max |
| Position | chr11: 2577854-2579263 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat, CIRI, find_circ |
| Parent gene | GLYMA_11G035800 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_11G035800_circ_g.1 |
| Support reads | NA |
| Tissues | root, stem, flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH28154:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs |
ghi_circ_003444 gra_circ_000873 gar_circ_000746 ghi_circ_003443 ghi_circ_001551 ghi_circ_001550 |
| PMCS | 0.47687273 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2579248-2579212(-) |
| Potential amino acid sequence |
MDETAVSSDPVIAFLLDEVVVKDWCKRTFKNIIAELQGIYDMDILGLKERLSLLLKFSLYLKGI SNVLDILESSFKGTLSAQLHDLQNLQESIMKTKQHMDVIIWCTRHQFLEGVRSRFTDGSSWSSV VRIRKSEAIRRAWPDAINQSVESQGHDGSLFIEDALNNLDLEEGFRNEIVEGLEIASLQKDSAS FLGSNTDQMLGYYPFKNLRSAVDLLFLHGGSDMVVAKQAITSLMYVWMKLLFPVILS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | cytoplasmic male sterility |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a; Chen et al., 2018 |