Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_01G207400_circ_g.1 |
| ID in PlantcircBase | gma_circ_000224 |
| Alias | Gm01circRNA861 |
| Organism | Glycine max |
| Position | chr1: 53934829-53936075 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat, CIRI |
| Parent gene | GLYMA_01G207400 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | GLYMA_01G207400_circ_g.2 GLYMA_01G207400_circ_g.3 |
| Support reads | NA |
| Tissues | leaf, root, stem |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRH77334:2 KRH77333:3 KRH77332:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs |
ghi_circ_003444* gra_circ_000873* gar_circ_000746* ghi_circ_003443 ghi_circ_001551* ghi_circ_001550 |
| PMCS | 0.606085151 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
53934847-53934903(+) |
| Potential amino acid sequence |
MDETAVSSDPVIAFLLDEVVVKDWCKRTFKNIIAELQGIYNMDILGLKERLSLLLKFSLYLKGI SNVLDILESSFKGTLSAQLHDLQNLQESIMKTKQHMDVIIWCTRHQFLEDVRSRFTDSSSWSSV VRTRKSEAIRRAWPDPINQSVESSGHDGSLFIEDAMNNLDLEEGFRNEIVEGLEIASLQKDSES FLGSNTDQILGYYPFKNLRSAVDLLFLRGGSDMVIAKQAITSQMYVWMKLLFPVILSLHFCWMK W*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |