Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0286800_circ_g.13 |
| ID in PlantcircBase | osa_circ_009091 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 10364108-10364953 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0286800 |
| Parent gene annotation |
Squalene cyclase domain containing protein. (Os11t0286800-01);Si milar to Cycloartenol synthase. (Os11t0286800-02);Similar to Cyc loartenol synthase. (Os11t0286800-03);Similar to Cycloartenol sy nthase. (Os11t0286800-04) |
| Parent gene strand | - |
| Alternative splicing | Os11g0286500_circ_ag.1 Os11g0286500_circ_ag.2 Os11g0286800_circ_g.1 Os11g0286800_circ_g.2 Os11g0286800_circ_g.3 Os11g0286800_circ_g.4 Os11g0286800_circ_g.5 Os11g0286800_circ_g.6 Os11g0286800_circ_g.7 Os11g0286800_circ_g.8 Os11g0286800_circ_g.9 Os11g0286800_circ_g.10 Os11g0286800_circ_g.11 Os11g0286800_circ_g.12 Os11g0286800_circ_g.14 Os11g0286800_circ_g.15 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0286800-02:2 Os11t0286800-01:2 Os11t0286800-03:2 Os11t0286800-04:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.428492412 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10364253-10364110(-) |
| Potential amino acid sequence |
MVYMPMSYIYAKRFIGPITPTILALREELYDVPYNKINWNNARISCCKVIGVYDWSGNNPIIPE LWLLPHFLPIHPGRFWCFCRMVYMPMSYIYAKRFIGPITPTILALREELYDVPYNKINWNNARI SCCKVIGVYDWSGNNPIIPELWLLPHFLPIHPGRFWCFCRMVYMPMSYIYAKRFIGPITPTILA LREELYDVPYNKINWNNARISCCKVIGVYDWSGNNPIIPELWLLPHFLPIHPGRFWCFCRMVYM PMSYIYAKRFIGPITPTILALREELYDVPYNKINWNNARISCCK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |