Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0194900_circ_g.21 |
ID in PlantcircBase | osa_circ_030053 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 4800114-4800306 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0195025 |
Parent gene annotation |
Hypothetical protein. (Os06t0195025-00) |
Parent gene strand | + |
Alternative splicing | Os06g0194900_circ_g.12 Os06g0194900_circ_g.13 Os06g0194900_circ_g.14 Os06g0194900_circ_g.15 Os06g0194900_circ_g.16 Os06g0194900_circ_g.17 Os06g0194900_circ_g.18 Os06g0194900_circ_g.19 Os06g0194900_circ_g.20 Os06g0194900_circ_g.22 Os06g0194900_circ_g.23 Os06g0194900_circ_g.24 Os06g0194900_circ_g.25 Os06g0194900_circ_g.26 Os06g0194900_circ_g.27 Os06g0194900_circ_g.28 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0194900-02:1 Os06t0194900-04:1 Os06t0194900-03:1 Os06t0194900-01:1 Os06t0194900-02:1 Os06t0194900-04:1 Os06t0194900-03:1 Os06t0195025-00:1 Os06t0194900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.477194991 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4800130-4800202(+) 4800227-4800202(+) 4800241-4800285(-) |
Potential amino acid sequence |
MGFQEVQQGVEALLVLEQLGRQVTVKELHPISDGLGHGRAREGGIEGLKIKLKNKVAVGACPCG YGLSGSSARGRGSPCPGTTWTTGDG*(+) MDLDMDGRGKEALKGSKSSSRTKLLLVRALVVMGFQEVQQGVEALLVLEQLGRQVTVKELHPIS DGLGHGRAREGGIEGLKIKLKNKVAVGACPCGYGLSGSSARGRGSPCPGTTWTTGDG*(+) MSKSIGNGVQFLNRHLSSKLFQDKESLYPLLNFLKAHNHKGTHQQQLCS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |