Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0194900_circ_g.16 |
| ID in PlantcircBase | osa_circ_030048 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 4798636-4798802 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0195025 |
| Parent gene annotation |
Hypothetical protein. (Os06t0195025-00) |
| Parent gene strand | + |
| Alternative splicing | Os06g0194900_circ_g.12 Os06g0194900_circ_g.13 Os06g0194900_circ_g.14 Os06g0194900_circ_g.15 Os06g0194900_circ_g.17 Os06g0194900_circ_g.18 Os06g0194900_circ_g.19 Os06g0194900_circ_g.20 Os06g0194900_circ_g.21 Os06g0194900_circ_g.22 Os06g0194900_circ_g.23 Os06g0194900_circ_g.24 Os06g0194900_circ_g.25 Os06g0194900_circ_g.26 Os06g0194900_circ_g.27 Os06g0194900_circ_g.28 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0194900-01:1 Os06t0194900-03:1 Os06t0194900-02:1 Os06t0194900-04:1 Os06t0194900-01:1 Os06t0194900-03:1 Os06t0195025-00:1 Os06t0194900-02:1 Os06t0194900-04:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.687548154 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4798716-4798715(+) 4798789-4798680(+) 4798690-4798687(-) |
| Potential amino acid sequence |
MRSGTGCQTCPSICLSWGIWFSPRHEQWYTSSNFLECTGDDEISVIHGDKISSELA*(+) MSNGTLPAISWNVLVMMKSV*(+) MNHTDFIITSTFQEIAGSVPLLMPWRKPNTPTQTYTWTSLTASTTSHANSLLILSP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |