Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0689100_circ_g.7 |
| ID in PlantcircBase | osa_circ_021048 |
| Alias | Os03circ22993 |
| Organism | Oryza sativa |
| Position | chr3: 27494802-27495078 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os03g0689100 |
| Parent gene annotation |
Histidine acid phosphatase family protein. (Os03t0689100-01);Sim ilar to predicted protein. (Os03t0689100-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0689100_circ_g.1 Os03g0689100_circ_g.2 Os03g0689100_circ_g.3 Os03g0689100_circ_g.4 Os03g0689100_circ_g.5 Os03g0689100_circ_g.6 Os03g0689100_circ_g.8 Os03g0689100_circ_g.9 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0689100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.177194946 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27494843-27494808(+) |
| Potential amino acid sequence |
MPQGSLYHQQGLAGKVTVMLRIWSILKSFVKSKQYWRRQN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |