Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0689100_circ_g.5 |
| ID in PlantcircBase | osa_circ_021046 |
| Alias | Os_ciR2520 |
| Organism | Oryza sativa |
| Position | chr3: 27492771-27493783 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0689100 |
| Parent gene annotation |
Histidine acid phosphatase family protein. (Os03t0689100-01);Sim ilar to predicted protein. (Os03t0689100-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0689100_circ_g.1 Os03g0689100_circ_g.2 Os03g0689100_circ_g.3 Os03g0689100_circ_g.4 Os03g0689100_circ_g.6 Os03g0689100_circ_g.7 Os03g0689100_circ_g.8 Os03g0689100_circ_g.9 |
| Support reads | 8/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0689100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.147087669 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27492841-27493780(+) 27492802-27493753(-) |
| Potential amino acid sequence |
MRNPDGKEVRYPVLLTPTEKQMSRDVCSAFRQMVYTVGPGYAHAEARKSPVVDGVVMRNPDGKE VRYPVLLTPTEKQMSRDVCSAFRQMVYTVGPGYAHAEARKSPVVDGVVMRNPDGKEVRYPVLLT PTEKQMSRDVCSAFRQMVYTVGPGYAHAEARKSPVVDGVVMRNPDGKEVRYPVLLTPTEKQMSR DVCSAFRQM(+) MCISWANCVNHLPKSTAHVS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |