Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0320400_circ_g.4 |
| ID in PlantcircBase | osa_circ_006455 |
| Alias | Os_ciR1164 |
| Organism | Oryza sativa |
| Position | chr10: 8693803-8694123 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
| Parent gene | Os10g0320400 |
| Parent gene annotation |
Similar to ATP synthase gamma chain, mitochondrial precursor (EC 3.6.3.14). (Os10t0320400-01) |
| Parent gene strand | + |
| Alternative splicing | Os10g0320400_circ_igg.1 Os10g0320400_circ_g.1 Os10g0320400_circ_g.2 Os10g0320400_circ_g.3 Os10g0320400_circ_g.5 Os10g0320400_circ_g.6 Os10g0320400_circ_g.7 Os10g0320400_circ_g.8 |
| Support reads | 15/22 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0320400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002772* osi_circ_008854 |
| PMCS | 0.558853946 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8694080-8693829(+) 8694025-8694112(-) |
| Potential amino acid sequence |
MTVSELQKNPINYTQVSMSRRMLL*(+) MTYLLSFSGPEVNLWSALLTLTDVELIPPQRPLSEVMATITFFLTSTPVCS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |