Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0442000_circ_g.5 |
ID in PlantcircBase | osa_circ_023936 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 22008223-22008942 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0442000 |
Parent gene annotation |
Similar to Auxin response factor 2 (ARF1-binding protein) (ARF1- BP). (Os04t0442000-01) |
Parent gene strand | + |
Alternative splicing | Os04g0442000_circ_g.4 Os04g0442000_circ_g.6 Os04g0442000_circ_g.7 Os04g0442000_circ_g.8 Os04g0442000_circ_g.9 Os04g0442000_circ_g.10 Os04g0442000_circ_g.11 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0442000-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_001047 |
PMCS | 0.320426285 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22008513-22008298(+) 22008284-22008582(-) |
Potential amino acid sequence |
MSQNPPCQELVAKDLHGTEWHFRHIFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFLSKVNSPV WILSFKILRNAQLIPFARH*(+) MSCAFLKILKLRIQTGEFTLLRKINASPATNLFELTKTLQPVVSRCLLGCPRKM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |