Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0442000_circ_g.5 |
| ID in PlantcircBase | osa_circ_023936 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 22008223-22008942 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0442000 |
| Parent gene annotation |
Similar to Auxin response factor 2 (ARF1-binding protein) (ARF1- BP). (Os04t0442000-01) |
| Parent gene strand | + |
| Alternative splicing | Os04g0442000_circ_g.4 Os04g0442000_circ_g.6 Os04g0442000_circ_g.7 Os04g0442000_circ_g.8 Os04g0442000_circ_g.9 Os04g0442000_circ_g.10 Os04g0442000_circ_g.11 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0442000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_001047 |
| PMCS | 0.320426285 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22008513-22008298(+) 22008284-22008582(-) |
| Potential amino acid sequence |
MSQNPPCQELVAKDLHGTEWHFRHIFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFLSKVNSPV WILSFKILRNAQLIPFARH*(+) MSCAFLKILKLRIQTGEFTLLRKINASPATNLFELTKTLQPVVSRCLLGCPRKM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |