Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G26080_circ_g.16 |
| ID in PlantcircBase | ath_circ_014879 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 11111275-11111400 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT2G26080 |
| Parent gene annotation |
Glycine dehydrogenase (decarboxylating) 2, mitochondrial |
| Parent gene strand | - |
| Alternative splicing | AT2G26080_circ_g.1 AT2G26080_circ_g.2 AT2G26080_circ_g.3 AT2G26080_circ_g.4 AT2G26080_circ_g.5 AT2G26080_circ_g.6 AT2G26080_circ_g.7 AT2G26080_circ_g.8 AT2G26080_circ_g.9 AT2G26080_circ_g.10 AT2G26080_circ_g.11 AT2G26080_circ_g.12 AT2G26080_circ_g.13 AT2G26080_circ_g.14 AT2G26080_circ_g.15 AT2G26080_circ_g.17 AT2G26080_circ_g.18 AT2G26080_circ_g.19 |
| Support reads | 106 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G26080.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.169310847 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11111398-11111277(-) 11111331-11111277(-) |
| Potential amino acid sequence |
MFTNLGELLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHMEMFTNLGELLCTITGFDSFSLQP NAGAAGEYAGLMVIRAYHMEMFTNLGELLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHMEMF TNLGELLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHM(-) MPVLLASTPGSWLSVHIIWKCLRIWVSSYVRSLDSTLSHCNLMPVLLASTPGSWLSVHIIWKCL RIWVSSYVRSLDSTLSHCNLMPVLLASTPGSWLSVHIIWKCLRIWVSSYVRSLDSTLSHCNLMP VLLASTPGSWLSVHII(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |