Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0317200_circ_g.10 |
ID in PlantcircBase | osa_circ_027420 |
Alias | Os_ciR9793 |
Organism | Oryza sativa |
Position | chr5: 14699111-14699242 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os05g0317200 |
Parent gene annotation |
AMP-dependent synthetase and ligase domain containing protein. ( Os05t0317200-01) |
Parent gene strand | + |
Alternative splicing | Os05g0317200_circ_g.1 Os05g0317200_circ_g.2 Os05g0317200_circ_g.3 Os05g0317200_circ_g.4 Os05g0317200_circ_g.5 Os05g0317200_circ_g.6 Os05g0317200_circ_g.7 Os05g0317200_circ_g.8 Os05g0317200_circ_g.9 Os05g0317200_circ_g.11 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0317200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.443617992 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14699157-14699239(+) 14699215-14699174(+) |
Potential amino acid sequence |
MPRGEVVVGGYSITKGYFNNEAKTNEVYKLVSWEEGGYKISDSPMPRGEVVVGGYSITKGYFNN EAKTNEVYKLVSWEEGGYKISDSPMPRGEVVVGGYSITKGYFNNEAKTNEVYKLVSWEEGGYKI SDSPMPRGEVVVGGYSITKGYFNNEAKTNEVYK(+) MKQKQMRSTSSFHGKKVAIKFLILQCPEERL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |