Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0317200_circ_g.10 |
| ID in PlantcircBase | osa_circ_027420 |
| Alias | Os_ciR9793 |
| Organism | Oryza sativa |
| Position | chr5: 14699111-14699242 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os05g0317200 |
| Parent gene annotation |
AMP-dependent synthetase and ligase domain containing protein. ( Os05t0317200-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0317200_circ_g.1 Os05g0317200_circ_g.2 Os05g0317200_circ_g.3 Os05g0317200_circ_g.4 Os05g0317200_circ_g.5 Os05g0317200_circ_g.6 Os05g0317200_circ_g.7 Os05g0317200_circ_g.8 Os05g0317200_circ_g.9 Os05g0317200_circ_g.11 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0317200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.443617992 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14699157-14699239(+) 14699215-14699174(+) |
| Potential amino acid sequence |
MPRGEVVVGGYSITKGYFNNEAKTNEVYKLVSWEEGGYKISDSPMPRGEVVVGGYSITKGYFNN EAKTNEVYKLVSWEEGGYKISDSPMPRGEVVVGGYSITKGYFNNEAKTNEVYKLVSWEEGGYKI SDSPMPRGEVVVGGYSITKGYFNNEAKTNEVYK(+) MKQKQMRSTSSFHGKKVAIKFLILQCPEERL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |