Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0295800_circ_g.3 |
ID in PlantcircBase | osa_circ_033415 |
Alias | Os07circ06137/Os_ciR1459 |
Organism | Oryza sativa |
Position | chr7: 11554926-11556122 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
Parent gene | Os07g0295800 |
Parent gene annotation |
Similar to peptidase. (Os07t0295800-01) |
Parent gene strand | - |
Alternative splicing | Os07g0295800_circ_g.1 Os07g0295800_circ_g.2 Os07g0295800_circ_g.4 Os07g0295800_circ_g.5 Os07g0295800_circ_g.6 Os07g0295800_circ_g.7 Os07g0295800_circ_g.8 Os07g0295800_circ_g.9 |
Support reads | 2/11/2 |
Tissues | leaf/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0295800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007125* osi_circ_016945 |
PMCS | 0.448543539 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11556015-11555014(+) 11554934-11556113(-) |
Potential amino acid sequence |
MEVLASHRLAIGVTGPKHHPTTNPITDPTMTSATKYPTMNFCRSDTFLQKIIVSYPSAILLPQA HY*(+) MVGYFVADVIVGSVIGLVVGWCFGPVTPIASRWLAKTSILHGLLQVTVVGLAISSQLFPYSTGA PKRVVLQHTFVTDANSIVESHYGFSVVDANSLEFLFNNAPEAAKWLKDNSLLSFEEKYHSDRSS WLDIL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |