Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0295800_circ_g.1 |
| ID in PlantcircBase | osa_circ_033413 |
| Alias | Os_ciR10855 |
| Organism | Oryza sativa |
| Position | chr7: 11552906-11555086 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0295800 |
| Parent gene annotation |
Similar to peptidase. (Os07t0295800-01) |
| Parent gene strand | - |
| Alternative splicing | Os07g0295800_circ_g.2 Os07g0295800_circ_g.3 Os07g0295800_circ_g.4 Os07g0295800_circ_g.5 Os07g0295800_circ_g.6 Os07g0295800_circ_g.7 Os07g0295800_circ_g.8 Os07g0295800_circ_g.9 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0295800-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.21703686 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11553324-11554987(-) |
| Potential amino acid sequence |
MVIQKTSSNNGHRRMHLELSLGSLSEIWTSVLNITGPLSNWSFSDMTLPDPQSFSGGPPSYICR LSGESHENWSFWLEMLIVLWSHTMVSLWLMLIHWSFFSIMRLRQQNG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |