Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0264500_circ_g.1 |
ID in PlantcircBase | osa_circ_011052 |
Alias | Os_ciR132 |
Organism | Oryza sativa |
Position | chr12: 9351219-9353718 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Os12g0264500 |
Parent gene annotation |
Similar to CoA-thioester hydrolase CHY1 (3-hydroxyisobutyryl-coe nzyme A hydrolase). (Os12t0264500-01);Similar to CHY1. (Os12t026 4500-02);Conserved hypothetical protein. (Os12t0264500-03);Simil ar to cDNA clone:J013000A22, full insert sequence. (Os12t0264500 -04) |
Parent gene strand | + |
Alternative splicing | Os12g0264500_circ_igg.1 Os12g0264500_circ_igg.2 Os12g0264500_circ_g.2 Os12g0264500_circ_g.3 Os12g0264500_circ_g.4 Os12g0264500_circ_g.5 Os12g0264500_circ_g.6 Os12g0264500_circ_g.7 Os12g0264500_circ_g.8 Os12g0264500_circ_g.9 Os12g0264500_circ_g.10 Os12g0264500_circ_g.11 Os12g0264500_circ_g.12 Os12g0264500_circ_g.13 Os12g0264500_circ_g.14 Os12g0264500_circ_g.15 Os12g0264500_circ_g.16 Os12g0264500_circ_g.17 Os12g0264500_circ_g.18 Os12g0264500_circ_g.19 Os12g0264500_circ_g.20 Os12g0264500_circ_g.21 Os12g0264500_circ_g.22 Os12g0264500_circ_g.23 Os12g0264500_circ_g.24 Os12g0264500_circ_g.25 Os12g0264500_circ_g.26 Os12g0264500_circ_g.27 |
Support reads | 837/23 |
Tissues | root/shoot, seed, pistil |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0264500-01:2 Os12t0264500-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.70331931 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9351282-9351313(-) 9353640-9351221(-) |
Potential amino acid sequence |
MPQQEQRLIDLCGGLVALHDTFAVAFHAGPIGFLAAAVGVGGGLYLLDAHRRSW*(-) MLTGDLGRRNLAVHSIYRCLSRSSGSSTFAEDSLLCTTPSPSPSTRGRLASSPPPLASGAASTS SMLTGDLGRRNLAVHSIYRCLSRSSGSSTFAEDSLLCTTPSPSPSTRGRLASSPPPLASGAAST SSMLTGDLGRRNLAVHSIYRCLSRSSGSSTFAEDSLLCTTPSPSPSTRGRLASSPPPLASGAAS TSSMLTGDLGRRNLAVHSIYRCLSRSSGSSTFAEDSLLCTT(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |