Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0264500_circ_g.15 |
| ID in PlantcircBase | osa_circ_011066 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 9357980-9358773 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0264500 |
| Parent gene annotation |
Similar to CoA-thioester hydrolase CHY1 (3-hydroxyisobutyryl-coe nzyme A hydrolase). (Os12t0264500-01);Similar to CHY1. (Os12t026 4500-02);Conserved hypothetical protein. (Os12t0264500-03);Simil ar to cDNA clone:J013000A22, full insert sequence. (Os12t0264500 -04) |
| Parent gene strand | + |
| Alternative splicing | Os12g0264500_circ_igg.1 Os12g0264500_circ_igg.2 Os12g0264500_circ_g.1 Os12g0264500_circ_g.2 Os12g0264500_circ_g.3 Os12g0264500_circ_g.4 Os12g0264500_circ_g.5 Os12g0264500_circ_g.6 Os12g0264500_circ_g.7 Os12g0264500_circ_g.8 Os12g0264500_circ_g.9 Os12g0264500_circ_g.10 Os12g0264500_circ_g.11 Os12g0264500_circ_g.12 Os12g0264500_circ_g.13 Os12g0264500_circ_g.14 Os12g0264500_circ_g.16 Os12g0264500_circ_g.17 Os12g0264500_circ_g.18 Os12g0264500_circ_g.19 Os12g0264500_circ_g.20 Os12g0264500_circ_g.21 Os12g0264500_circ_g.22 Os12g0264500_circ_g.23 Os12g0264500_circ_g.24 Os12g0264500_circ_g.25 Os12g0264500_circ_g.26 Os12g0264500_circ_g.27 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0264500-02:3 Os12t0264500-03:3 Os12t0264500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.131746799 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9358059-9358023(+) 9358772-9358023(+) 9358015-9358218(-) |
| Potential amino acid sequence |
MITCFLRCFTAYEEDDGVKLLIVKGKGRAFCAGGDVAAVVRSINNGFGRSKWCNTDIGFE*(+) MVLVEANGVTRTLVLNRPKQLNALSSAMITCFLRCFTAYEEDDGVKLLIVKGKGRAFCAGGDVA AVVRSINNGFGRSKWCNTDIGFE*(+) MSVLHHLLLPKPLFIDRTTAATSPPAQNALPFPFTINSLTPSSSS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |