Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0684500_circ_g.4 |
ID in PlantcircBase | osa_circ_026032 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 34964387-34964682 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0684500 |
Parent gene annotation |
Pentatricopeptide repeat domain containing protein. (Os04t068450 0-01);Hypothetical conserved gene. (Os04t0684500-02) |
Parent gene strand | + |
Alternative splicing | Os04g0684500_circ_g.2 Os04g0684500_circ_g.3 Os04g0684500_circ_g.5 Os04g0684500_circ_g.6 Os04g0684500_circ_g.7 Os04g0684500_circ_g.8 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0684500-01:1 Os04t0684500-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005855* |
PMCS | 0.551792108 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34964418-34964465(+) 34964451-34964559(-) |
Potential amino acid sequence |
MSIAGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIKESGLKLDVYIYETLLRACCKSGRMQSA LAVTREMSFQKIPRNTFIYNILIDGFKELSLCLIRCPSLALHQMSIHTQSL*(+) MLIWCNASDGHLIKHRDSSLNPSIKILYINVFLGIFWKLISRVTAKALCILPDLQQALSNVS*( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |