Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA017382_circ_g.4 |
ID in PlantcircBase | osi_circ_005855 |
Alias | 4:34168541|34168836 |
Organism | Oryza sativa ssp. indica |
Position | chr4: 34168541-34168836 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA017382 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA017382_circ_g.1 BGIOSGA017382_circ_g.2 BGIOSGA017382_circ_g.3 BGIOSGA017382_circ_igg.1 BGIOSGA017382_circ_igg.2 BGIOSGA017382_circ_igg.3 BGIOSGA017382_circ_igg.4 BGIOSGA017382_circ_igg.5 BGIOSGA017382_circ_igg.6 BGIOSGA017382_circ_igg.7 BGIOSGA017382_circ_igg.8 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA017382-TA:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_026032* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34168605-34168713(-) 34168572-34168619(+) |
Potential amino acid sequence |
MLIWCNASDGHLIKHRDSSLNPSIKILYINVFLGIFWKLISRVTAKALCILPDLQQALSNVS*( -) MSIAGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIKESGLKLDVYIYETLLRACCKSGRMQSA LAVTREMSFQKIPRNTFIYNILIDGFKELSLCLIRCPSLALHQMSIHTQSL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |