Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0599900_circ_g.3 |
ID in PlantcircBase | osa_circ_025057 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 30274179-30274866 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0599900 |
Parent gene annotation |
Similar to ENTH1 protein (Fragment). (Os04t0599900-01);Similar t o ENTH1 protein (Fragment). (Os04t0599900-02);Similar to B0403H1 0-OSIGBa0105A11.1 protein. (Os04t0599900-03) |
Parent gene strand | + |
Alternative splicing | Os04g0599900_circ_g.1 Os04g0599900_circ_g.2 Os04g0599900_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0599900-01:2 Os04t0599900-02:2 Os04t0599900-03:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014737 |
PMCS | 0.166624988 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30274212-30274181(+) 30274741-30274857(-) |
Potential amino acid sequence |
MQKAMRTILMILILVDLLQMVQLIQTPVAWIFLPQTYWMISSMCLQQQLMKQTTLQTLRLICLL MQISNQQYQVQKQLRVQMSRNEDSPSSLKSNAKGNEDDFDDFDPRGSSSNGAANTNTSGVDLFA PNLLDDFIDVPAAATHETNDSADAQVDLFADADFQSAIPSTETAAGSDVQE*(+) MKSSNKFGAKRSTPLVFVLAAPFEEDPRGSKSSKSSSLPFALDFKELGESSFLDI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |