Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0599900_circ_g.4 |
| ID in PlantcircBase | osa_circ_025058 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 30274676-30274866 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0599900 |
| Parent gene annotation |
Similar to ENTH1 protein (Fragment). (Os04t0599900-01);Similar t o ENTH1 protein (Fragment). (Os04t0599900-02);Similar to B0403H1 0-OSIGBa0105A11.1 protein. (Os04t0599900-03) |
| Parent gene strand | + |
| Alternative splicing | Os04g0599900_circ_g.1 Os04g0599900_circ_g.2 Os04g0599900_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0599900-03:1 Os04t0599900-01:1 Os04t0599900-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.401148953 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30274731-30274682(+) 30274741-30274738(-) |
| Potential amino acid sequence |
MISSMCLQQQLMKQTTLQTLRLICLLMQISNQQYQVQKQLRVQMSRCS*(+) MKSSNKFGAKRSTPLVFVLAAPGHLNPQLFLYLVLLIGNLHQQTDQPERLQSRLFHELLLQAHR *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |