Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA004748_circ_g.7 |
ID in PlantcircBase | osi_circ_002516 |
Alias | 1:39177393|39178043 |
Organism | Oryza sativa ssp. indica |
Position | chr1: 39177393-39178043 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA004748 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA004748_circ_g.1 BGIOSGA004748_circ_g.2 BGIOSGA004748_circ_g.3 BGIOSGA004748_circ_g.4 BGIOSGA004748_circ_g.5 BGIOSGA004748_circ_g.6 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA004748-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_004729* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
39177418-39177853(-) |
Potential amino acid sequence |
MSPAVCASLLVKFLQDKRLWEEHPRNSYNSHKQQKYLKFLLAPK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |