Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0834200_circ_g.11 |
| ID in PlantcircBase | osa_circ_004729 |
| Alias | Os_ciR915 |
| Organism | Oryza sativa |
| Position | chr1: 35740480-35741129 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os01g0834200 |
| Parent gene annotation |
Similar to T-cell immune regulator 1 transcript variant 3 (Fragm ent). (Os01t0834200-01);Similar to VHA-A1 (VACUOLAR PROTON ATPAS E A 1); ATPase. (Os01t0834200-02);Similar to T-cell immune regul ator 1 transcript variant 3 (Fragment). (Os01t0834200-03);Simila r to VHA-A1 (VACUOLAR PROTON ATPASE A 1); ATPase. (Os01t0834200- 04) |
| Parent gene strand | + |
| Alternative splicing | Os01g0834200_circ_g.2 Os01g0834200_circ_g.3 Os01g0834200_circ_g.4 Os01g0834200_circ_g.5 Os01g0834200_circ_g.6 Os01g0834200_circ_g.7 Os01g0834200_circ_g.8 Os01g0834200_circ_g.9 Os01g0834200_circ_g.10 |
| Support reads | 25/5 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0834200-04:3 Os01t0834200-01:3 Os01t0834200-03:3 Os01t0834200-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002516* osi_circ_010900 |
| PMCS | 0.594163462 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35740505-35740939(-) |
| Potential amino acid sequence |
MSPAVCASLLVKFLQDKRLWEEHPRNSYNSHKQQKYLKFLLAPK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |