Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G08520_circ_g.14 |
| ID in PlantcircBase | ath_circ_001414 |
| Alias | At_ciR1991 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 2699467-2699920 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ, CIRI-full |
| Parent gene | AT1G08520 |
| Parent gene annotation |
Mg-protoporphyrin IX chelatase |
| Parent gene strand | + |
| Alternative splicing | AT1G08520_circ_g.1 AT1G08520_circ_g.2 AT1G08520_circ_g.3 AT1G08520_circ_g.4 AT1G08520_circ_g.5 AT1G08520_circ_g.6 AT1G08520_circ_g.7 AT1G08520_circ_g.8 AT1G08520_circ_g.9 AT1G08520_circ_g.10 AT1G08520_circ_g.11 AT1G08520_circ_g.12 AT1G08520_circ_g.13 |
| Support reads | 4/22 |
| Tissues | leaf/leaf, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G08520.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.283491332 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2699584-2699917(+) |
| Potential amino acid sequence |
MRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQGPVKRLAVDATLRAA APYQKLRREKDISGTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLL AESYTSRDQGPVKRLAVDATLRAAAPYQKLRREKDISGTRKVFVEKTDMRAKRMARKAGALVIF VVDASGSMALNRMQNAKGAALKLLAESYTSRDQGPVKRLAVDATLRAAAPYQKLRREKDISGTR KVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |