Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0433200_circ_g.1 |
| ID in PlantcircBase | osa_circ_009245 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 13999003-13999574 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0433200 |
| Parent gene annotation |
Protease-associated domain, PA domain containing protein. (Os11t 0433200-01);Similar to predicted protein. (Os11t0433200-02) |
| Parent gene strand | + |
| Alternative splicing | Os11g0433200_circ_g.2 Os11g0433200_circ_g.3 Os11g0433200_circ_g.4 Os11g0433200_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0433200-01:3 Os11t0433200-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.370293069 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13999467-13999004(+) 13999097-13999502(-) |
| Potential amino acid sequence |
MVCSDNDTSINVTIPVVMIPQSAGKKMKGLLDQGARR*(+) MNISRHGGSKSCTQPNNNCTFSSIYPILHLNALLPDPRGPSSFFQLTVVSLQQVL*(-) |
| Sponge-miRNAs | osa-miR2931 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |