Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0433200_circ_g.2 |
ID in PlantcircBase | osa_circ_009246 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 13999003-14004152 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0433200 |
Parent gene annotation |
Protease-associated domain, PA domain containing protein. (Os11t 0433200-01);Similar to predicted protein. (Os11t0433200-02) |
Parent gene strand | + |
Alternative splicing | Os11g0433200_circ_g.1 Os11g0433200_circ_g.3 Os11g0433200_circ_g.4 Os11g0433200_circ_g.5 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0433200-02:10 Os11t0433200-01:10 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.201891429 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14001240-13999009(+) 13999097-14004149(-) |
Potential amino acid sequence |
MAIGTIVCASLWTEFVACEQVDERYNQLTRKDGPNSGTTNREDKEIFEISAKGAIVFILVASVF LLLLFYFMSSWFVWLLIVLFCIGGIEGMHVCLVTLLTRICKDCGQKTVQLPFFGEVLTLSVLIV PFCTIFAILWAVYRHASFAWIGQDILGICLMITVLQMARLPNIRVASALLSAAFVYDVFWVFIS PLIFHESVMIAVARGDNSGEAIPMLLRIPRFFDPWGGYDMIGFGDIIFPGLLVAFSYRLR*(+) MNISRHGGSKSCTQPNNNCTFSSIYPILHLNL*(-) |
Sponge-miRNAs | osa-miR2931 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |