Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0264500_circ_g.5 |
| ID in PlantcircBase | osa_circ_011056 |
| Alias | Os_ciR1427 |
| Organism | Oryza sativa |
| Position | chr12: 9353624-9354007 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI, find_circ |
| Parent gene | Os12g0264500 |
| Parent gene annotation |
Similar to CoA-thioester hydrolase CHY1 (3-hydroxyisobutyryl-coe nzyme A hydrolase). (Os12t0264500-01);Similar to CHY1. (Os12t026 4500-02);Conserved hypothetical protein. (Os12t0264500-03);Simil ar to cDNA clone:J013000A22, full insert sequence. (Os12t0264500 -04) |
| Parent gene strand | + |
| Alternative splicing | Os12g0264500_circ_igg.1 Os12g0264500_circ_igg.2 Os12g0264500_circ_g.1 Os12g0264500_circ_g.2 Os12g0264500_circ_g.3 Os12g0264500_circ_g.4 Os12g0264500_circ_g.6 Os12g0264500_circ_g.7 Os12g0264500_circ_g.8 Os12g0264500_circ_g.9 Os12g0264500_circ_g.10 Os12g0264500_circ_g.11 Os12g0264500_circ_g.12 Os12g0264500_circ_g.13 Os12g0264500_circ_g.14 Os12g0264500_circ_g.15 Os12g0264500_circ_g.16 Os12g0264500_circ_g.17 Os12g0264500_circ_g.18 Os12g0264500_circ_g.19 Os12g0264500_circ_g.20 Os12g0264500_circ_g.21 Os12g0264500_circ_g.22 Os12g0264500_circ_g.23 Os12g0264500_circ_g.24 Os12g0264500_circ_g.25 Os12g0264500_circ_g.26 Os12g0264500_circ_g.27 |
| Support reads | 14/2 |
| Tissues | root/seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0264500-02:2 Os12t0264500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.348347135 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9353640-9354002(-) |
| Potential amino acid sequence |
MLTGDLGRRNLAVHSIYRCLSRSSVTVLCSYRLIDLRGGLVALQDTFAVAFHAGPIGFLAAAVG VGGGLYLLDAHRRSW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |