Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0515800_circ_g.8 |
| ID in PlantcircBase | osa_circ_039843 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 20088681-20088818 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os09g0515800 |
| Parent gene annotation |
RabGAP/TBC domain containing protein. (Os09t0515800-01) |
| Parent gene strand | - |
| Alternative splicing | Os09g0515800_circ_g.1 Os09g0515800_circ_g.2 Os09g0515800_circ_g.3 Os09g0515800_circ_g.4 Os09g0515800_circ_g.5 Os09g0515800_circ_g.6 Os09g0515800_circ_g.7 Os09g0515800_circ_g.9 Os09g0515800_circ_g.10 |
| Support reads | 2 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0515800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.334537923 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20088694-20088683(-) 20088735-20088778(-) |
| Potential amino acid sequence |
MLRQGYAPPNADRREGVLTRKRLEYVECVSQYYDIPDTERSDEEINMLRQGYAPPNADRREGVL TRKRLEYVECVSQYYDIPDTERSDEEINMLRQGYAPPNADRREGVLTRKRLEYVECVSQYYDIP DTERSDEEINMLRQ(-) MIFLILNALMKRLICFDRDMHHLMQIEEKVF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |